Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdx1 Rabbit Polyclonal Antibody (HRP)

Cdx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cdx, Cdx-1

UniProt

P18111

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Cdx1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQQPLPPTQLPLPLDGTPTPSGPPLGSLCPTNAGLLGTPSPVPVKEEFLP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 100 medium ashless filter, 60 mm
QT43A0060 Box of 100

Box of 100 medium ashless filter, 60 mm

Sign In for Pricing
View Details
TNIP2, ID (TNIP2, ABIN2, FLIP1, TNFAIP3-interacting protein 2, A20-binding inhibitor of NF-kappa-B activation 2, Fetal liver LKB1-interacting protein) (MaxLight 550) discontinued
043092-ML550 100 µL

TNIP2, ID (TNIP2, ABIN2, FLIP1, TNFAIP3-interacting protein 2, A20-binding inhibitor of NF-kappa-B activation 2, Fetal liver LKB1-interacting protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Tβ-10 CRISPR/Cas9 KO Plasmid (h)
sc-407294 20 µg

Tβ-10 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Shewanella baltica UPF0434 protein Sbal195_1707 (Sbal195_1707)
MBS1179303-01 0.02 mg (E-Coli)

Recombinant Shewanella baltica UPF0434 protein Sbal195_1707 (Sbal195_1707)

Sign In for Pricing
View Details
Recombinant Shewanella baltica UPF0434 protein Sbal195_1707 (Sbal195_1707)
MBS1179303-02 0.1 mg (E-Coli)

Recombinant Shewanella baltica UPF0434 protein Sbal195_1707 (Sbal195_1707)

Sign In for Pricing
View Details
Recombinant Shewanella baltica UPF0434 protein Sbal195_1707 (Sbal195_1707)
MBS1179303-03 0.02 mg (Yeast)

Recombinant Shewanella baltica UPF0434 protein Sbal195_1707 (Sbal195_1707)

Sign In for Pricing
View Details