Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnmt1 Rabbit Polyclonal Antibody (HRP)

Dnmt1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MTa, Dnmt, MCMT, Met1, Cxxc9, MTase, Met-1, Dnmt1o, MommeD, m.MmuI, MommeD2

UniProt

P13864

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Dnmt1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

183kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_034196

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC11D3.14c Polyclonal Antibody
MBS7188567 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC11D3.14c Polyclonal Antibody

Sign In for Pricing
View Details
TL1A Protein, Human, Recombinant (mFc Tag)
E45H52192M3-100 100 µg

TL1A Protein, Human, Recombinant (mFc Tag)

Sign In for Pricing
View Details
PGM2 Human siRNA Oligo Duplex (Locus ID 55276)
SR310637 1 Kit

PGM2 Human siRNA Oligo Duplex (Locus ID 55276)

Sign In for Pricing
View Details
P21 Ras (HRAS) Mouse Monoclonal Antibody [Clone 1H3]
E45M13359V-2 50 µL

P21 Ras (HRAS) Mouse Monoclonal Antibody [Clone 1H3]

Sign In for Pricing
View Details
Fstl1 Mouse siRNA Oligo Duplex (Locus ID 14314)
SR409048 1 Kit

Fstl1 Mouse siRNA Oligo Duplex (Locus ID 14314)

Sign In for Pricing
View Details
Map2k5 Mouse shRNA Plasmid (Locus ID 23938)
TL502520 1 Kit

Map2k5 Mouse shRNA Plasmid (Locus ID 23938)

Sign In for Pricing
View Details