Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eomes Rabbit Polyclonal Antibody (Biotin)

Eomes Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tbr, Tbr2, TBR-2, C77258

UniProt

O54839

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Eomes

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_034266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit
MBS7226426-01 48 Well

Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit

Sign In for Pricing
View Details
Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit
MBS7226426-02 96 Well

Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit

Sign In for Pricing
View Details
Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit
MBS7226426-03 5x 96 Well

Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit

Sign In for Pricing
View Details
Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit
MBS7226426-04 10x 96 Well

Rat Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit

Sign In for Pricing
View Details
Horse Homeobox Protein ARX (ARX) ELISA Kit
MBS9373728-01 48 Well

Horse Homeobox Protein ARX (ARX) ELISA Kit

Sign In for Pricing
View Details
Horse Homeobox Protein ARX (ARX) ELISA Kit
MBS9373728-02 96 Well

Horse Homeobox Protein ARX (ARX) ELISA Kit

Sign In for Pricing
View Details