Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fkhl18 Rabbit Polyclonal Antibody (FITC)

Fkhl18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fkh3, FREAC, Fkhl1, Fkhl18, FREAC10

UniProt

Q61574

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Fkhl18

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034356

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal Serpin E1/PAI-1 Antibody (Sanofi patent anti-PAI-1) [DyLight 405]
NBP3-27963V 0.1 mL

Human Monoclonal Serpin E1/PAI-1 Antibody (Sanofi patent anti-PAI-1) [DyLight 405]

Sign In for Pricing
View Details
C2orf37 CRISPR All-in-one AAV vector set (with saCas9)(Human)
53770151 3x 1.0 µg DNA

C2orf37 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Mouse IL-1 Alpha/IL-1F1/IL1A ELISA Kit PicoKine®, Carrier-free
EK0391-carrier-free 96 Well With Removable Strips

Mouse IL-1 Alpha/IL-1F1/IL1A ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
KIF17 Antibody
A67332-50UG 50 µg

KIF17 Antibody

Sign In for Pricing
View Details
Gap junction alpha-8 protein (GJA8) Rat ELISA Kit
D6211 96 Tests

Gap junction alpha-8 protein (GJA8) Rat ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal PD-1 Antibody (PDCD1/7255R) [DyLight 594]
NBP3-20956DL594 0.1 mL

Rabbit Monoclonal PD-1 Antibody (PDCD1/7255R) [DyLight 594]

Sign In for Pricing
View Details