Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMG20B Rabbit Polyclonal Antibody (HRP)

HMG20B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BRAF, Smar, Hmgx2, BRAF35, Hmgxb2, AW610687, Smarce1r

UniProt

Q9Z104

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSHGPRQPGAATAPAGGKTPGQHGAFVVAVKQERSEGSRAGEKGPQEEEP

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RWDD2B (NM_016940) Human Over-expression Lysate
LS010069-20ug 20 µg

RWDD2B (NM_016940) Human Over-expression Lysate

Sign In for Pricing
View Details
Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit
MBS2601981-01 48 Well

Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit

Sign In for Pricing
View Details
Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit
MBS2601981-02 96 Well

Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit

Sign In for Pricing
View Details
Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit
MBS2601981-03 5x 96 Well

Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit

Sign In for Pricing
View Details
Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit
MBS2601981-04 10x 96 Well

Chicken Transcription Factor / Activator Protein 1 (AP-1) ELISA Kit

Sign In for Pricing
View Details
CBL-C, CT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (FITC) discontinued
C0013-34A-FITC 200 µL

CBL-C, CT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (FITC) discontinued

Sign In for Pricing
View Details