Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxa2 Rabbit Polyclonal Antibody (FITC)

Foxa2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hnf3, Hnf-3, Hnf3b, Tcf3b, HNF3be, Hnf-3b, Tcf-3b, HNF3-be, HNF3beta, HNF3-beta

UniProt

P35583

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma Putative proline iminopeptidase Protein, His-SUMO, E.coli-500ug
QP6964-500ug 500ug

Recombinant Mycoplasma Putative proline iminopeptidase Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
MSI1 Mouse Monoclonal Antibody [Clone 2G9]
E45M10793V-2 50 µL

MSI1 Mouse Monoclonal Antibody [Clone 2G9]

Sign In for Pricing
View Details
NDUFS6 Polyclonal Antibody, Cy3 Conjugated
bs-19092R-Cy3 100 µL

NDUFS6 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Lentiviral human DEFB1 sgRNA gene knockout kit - Lentiviral human DEFB1 sgRNA gene knockout kit (plasmid)
GTR15399224 1 Vial

Lentiviral human DEFB1 sgRNA gene knockout kit - Lentiviral human DEFB1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
AKAP13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV669740 1.0 µg DNA

AKAP13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human Elastase (Neutrophil ELA2) AssayMax™ ELISA Kit (Positive Control Included)
EE1001-7 96 Well

Human Elastase (Neutrophil ELA2) AssayMax™ ELISA Kit (Positive Control Included)

Sign In for Pricing
View Details