Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxa2 Rabbit Polyclonal Antibody (Biotin)

Foxa2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hnf3, Hnf-3, Hnf3b, Tcf3b, HNF3be, Hnf-3b, Tcf-3b, HNF3-be, HNF3beta, HNF3-beta

UniProt

P35583

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE human CD42a Antibody
orb3065993-01 25 Tests

PE human CD42a Antibody

Sign In for Pricing
View Details
PE human CD42a Antibody
orb3065993-02 100 Tests

PE human CD42a Antibody

Sign In for Pricing
View Details
pTAC18 Antibody
PHY0388S 150 μg

pTAC18 Antibody

Sign In for Pricing
View Details
SAP155 Rabbit Polyclonal Antibody (PE)
orb494824 100 µL

SAP155 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Lentiviral mouse Met shRNA (UAS) - Lentiviral mouse Met shRNA (UAS) (25)
GTR15205841 1 Vial

Lentiviral mouse Met shRNA (UAS) - Lentiviral mouse Met shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral human PEX12 sgRNA gene knockout kit - Lentiviral human PEX12 sgRNA gene knockout kit (plasmid)
GTR15372641 1 Vial

Lentiviral human PEX12 sgRNA gene knockout kit - Lentiviral human PEX12 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details