Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB7 Rabbit Polyclonal Antibody (Biotin)

HOXB7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hox-2., Hox-2.3, AI325018

UniProt

P09024

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse HOXB7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX1 Antibody - middle region : FITC (ARP32375_P050-FITC)
ARP32375_P050-FITC 100 µL

SIX1 Antibody - middle region : FITC (ARP32375_P050-FITC)

Sign In for Pricing
View Details
Rabbit Anti-Claudin 2 antibody
SL23849R-01 50 µL

Rabbit Anti-Claudin 2 antibody

Sign In for Pricing
View Details
Rabbit Anti-Claudin 2 antibody
SL23849R-02 100 µL

Rabbit Anti-Claudin 2 antibody

Sign In for Pricing
View Details
HSPB9 Antibody - middle region : FITC (ARP66184_P050-FITC)
ARP66184_P050-FITC 100 µL

HSPB9 Antibody - middle region : FITC (ARP66184_P050-FITC)

Sign In for Pricing
View Details
KIF15 Antibody, HRP conjugated
A67755-50UG 50 µg

KIF15 Antibody, HRP conjugated

Sign In for Pricing
View Details
ENPP2 Antibody
orb353547-01 50 μL

ENPP2 Antibody

Sign In for Pricing
View Details