Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB7 Rabbit Polyclonal Antibody (Biotin)

HOXB7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hox-2., Hox-2.3, AI325018

UniProt

P09024

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse HOXB7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD26 Protein, His Tag
TP724185 100 µg

Human CD26 Protein, His Tag

Sign In for Pricing
View Details
ViPrimePLUS OneStep Taq RT-qPCR Green Master Mix II, 500rxns
QLMM18-500 500 Reactions

ViPrimePLUS OneStep Taq RT-qPCR Green Master Mix II, 500rxns

Sign In for Pricing
View Details
Human Integrin Alpha 9 (ITGa9) ELISA Kit
EKN49450 96 Tests

Human Integrin Alpha 9 (ITGa9) ELISA Kit

Sign In for Pricing
View Details
USP9X Rabbit Polyclonal Antibody
orb668597-01 30 µL

USP9X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP9X Rabbit Polyclonal Antibody
orb668597-02 50 μL

USP9X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP9X Rabbit Polyclonal Antibody
orb668597-03 100 µL

USP9X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details