TFF3, Human (P. pastoris, His)
TFF3 Protein is crucial for maintaining and repairing the intestinal mucosa, promoting epithelial cell mobility as a motogen. As a monomer, TFF3 has individual effects, while as a disulfide-linked homodimer, it enhances cellular responses for intestinal lining integrity. TFF3's multifaceted nature underscores its significance in balancing mucosal maintenance and repair in the gastrointestinal tract. TFF3 Protein, Human (P. pastoris, His) is the recombinant human-derived TFF3 protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
TFF3 Protein, Human (P. pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tff3-protein-human-p-pastoris-his.html
Smiles
LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV
Molecular Formula
7033 (Gene_ID) Q07654 (L29-V80) (Accession)
Molecular Weight
Approximately 5-14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
