Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Itsn1 Rabbit Polyclonal Antibody (HRP)

Itsn1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ese, EHSH, Ese1, Itsn, Sh3p, Ehsh1, Sh3p17, AA517634, AA545208, AI316805, AI839402, AI848451

UniProt

Q6NZJ5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Itsn1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001103746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human HSP A9 Polyclonal Antibody
PA84386HU-01 50 µg

Rabbit Anti-Human HSP A9 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human HSP A9 Polyclonal Antibody
PA84386HU-02 100 µg

Rabbit Anti-Human HSP A9 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human HSP A9 Polyclonal Antibody
PA84386HU-03 500 µg

Rabbit Anti-Human HSP A9 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human HSP A9 Polyclonal Antibody
PA84386HU-04 1 mg

Rabbit Anti-Human HSP A9 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Mediator of RNA polymerase II transcription subunit 10 (MED10) ELISA Kit
MBS7219658-01 48 Well

Mouse Mediator of RNA polymerase II transcription subunit 10 (MED10) ELISA Kit

Sign In for Pricing
View Details
Mouse Mediator of RNA polymerase II transcription subunit 10 (MED10) ELISA Kit
MBS7219658-02 96 Well

Mouse Mediator of RNA polymerase II transcription subunit 10 (MED10) ELISA Kit

Sign In for Pricing
View Details