Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Itsn1 Rabbit Polyclonal Antibody (Biotin)

Itsn1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ese, EHSH, Ese1, Itsn, Sh3p, Ehsh1, Sh3p17, AA517634, AA545208, AI316805, AI839402, AI848451

UniProt

Q6NZJ5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Itsn1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001103746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal YME1L1 Antibody (OTI2G10) [Alexa Fluor 532]
NBP2-74906AF532 0.1 mL

Mouse Monoclonal YME1L1 Antibody (OTI2G10) [Alexa Fluor 532]

Sign In for Pricing
View Details
Nudt9 ORF Vector (Rat) (pORF)
ORF071607 1.0 µg DNA

Nudt9 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human LTBR (Lymphotoxin beta receptor) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (31-224aa)
MPX4435K Each

Magic™ Membrane Protein Human LTBR (Lymphotoxin beta receptor) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (31-224aa)

Sign In for Pricing
View Details
ARF5 Protein Vector (Human) (pPB-His-GST)
PV323167 500 ng

ARF5 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Recombinant Mouse RNA-binding protein 34 (Rbm34)
MBS1452831-01 0.02 mg (E-Coli)

Recombinant Mouse RNA-binding protein 34 (Rbm34)

Sign In for Pricing
View Details
Recombinant Mouse RNA-binding protein 34 (Rbm34)
MBS1452831-02 0.02 mg (Yeast)

Recombinant Mouse RNA-binding protein 34 (Rbm34)

Sign In for Pricing
View Details