Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf4 Rabbit Polyclonal Antibody (HRP)

Klf4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Zi, EZF, Gkl, Zie, Gklf

UniProt

Q60793

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSN

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034767

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6beta-Hydroxy Androstenedione
TRC-H828155-5MG 5 mg

6beta-Hydroxy Androstenedione

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF740 conjugate, 0.1mg/mL
BNC741761-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EIF4G1 (NM_198241) Human Recombinant Protein
TP319841M 100 µg

EIF4G1 (NM_198241) Human Recombinant Protein

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF594 conjugate, 0.1mg/mL
BNC940883-500 1x 500 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LZTFL1 Human Gene Knockout Kit (CRISPR)
KN207289BN 1 Kit

LZTFL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS506962 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details