Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx8 Rabbit Polyclonal Antibody (HRP)

Lhx8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L, L3, Lhx, Lhx7

UniProt

O35652

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Lhx8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQSMASGSVCPPGKCVCSSCG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034843

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Factor Erythroid Derived 2 (NFE2) (NM_001136023) Human Over-expression Lysate
LY427772 100 µg

Nuclear Factor Erythroid Derived 2 (NFE2) (NM_001136023) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MYO19 activation kit by CRISPRa
GA112854 1 Kit

Human MYO19 activation kit by CRISPRa

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL
BNC401485-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Smooth muscle
CS700044 5x 5 µm

Tissue FFPE Sections, Smooth muscle

Sign In for Pricing
View Details
LEFTY1+LEFTY2 Recombinant Rabbit Monoclonal Antibody [JE38-88]
HA722177 100 µL

LEFTY1+LEFTY2 Recombinant Rabbit Monoclonal Antibody [JE38-88]

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL
BNC700774-500 1x 500 µL

HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details