Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx9 Rabbit Polyclonal Antibody (Biotin)

Lhx9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LH2, LH2B, BB104635, 3110009O07Rik

UniProt

Q9WUH2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Lhx9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQGEQILGHYSQTSRRL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody
PA86501HU-01 50 µg

Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody
PA86501HU-02 100 µg

Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody
PA86501HU-03 500 µg

Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody
PA86501HU-04 1 mg

Rabbit Anti-Human Olfactory receptor 7C1 Polyclonal Antibody

Sign In for Pricing
View Details
5L White Round Bucket with Tamper Evident Push Lid and Handle
RRPL5000-60 60 / PCK

5L White Round Bucket with Tamper Evident Push Lid and Handle

Sign In for Pricing
View Details
RPL17P39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1916206 1.0 µg DNA

RPL17P39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details