Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7A Rabbit Polyclonal Antibody (Biotin)

ZBTB7A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L, Lrf, Pok, FBI-, FBI-1, Zbtb7, Pokemon, AI452336, 9030619K07Rik, 9130006G12Rik

UniProt

O88939

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ZBTB7A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Longer Turning Tool to open High Contrast Grid Storage Boxes (30% longer than the standard)
M-CEM-TT01-XL 1 Unit

Longer Turning Tool to open High Contrast Grid Storage Boxes (30% longer than the standard)

Sign In for Pricing
View Details
Vibrio cholerae ctxB/Cholera Toxin Subunit B Antibody
E55A12160 100 µg

Vibrio cholerae ctxB/Cholera Toxin Subunit B Antibody

Sign In for Pricing
View Details
PCDH15 Antibody
CSB-PA853490ESR1HU-01 50 μL

PCDH15 Antibody

Sign In for Pricing
View Details
PCDH15 Antibody
CSB-PA853490ESR1HU-02 100 µL

PCDH15 Antibody

Sign In for Pricing
View Details
Bovine 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase beta-2(PLCB2) ELISA Kit
MBS2610349-01 48 Well

Bovine 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase beta-2(PLCB2) ELISA Kit

Sign In for Pricing
View Details
Bovine 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase beta-2(PLCB2) ELISA Kit
MBS2610349-02 96 Well

Bovine 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase beta-2(PLCB2) ELISA Kit

Sign In for Pricing
View Details