Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Rabbit Polyclonal Antibody (HRP)

Mxd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ma, Mad, Mad1, AW122478

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin 3 (CAV3) (N-term) Rabbit Polyclonal Antibody
AP17187PU-N 400 µL

Caveolin 3 (CAV3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin D2 (CCND2/2620), 0.2mg/mL
BNUB2620-500 1x 500 µL

Cyclin D2 (CCND2/2620), 0.2mg/mL

Sign In for Pricing
View Details
2-(Pyridin-2-yl)acetic Acid
TRC-P993353-2.5G 2.5 g

2-(Pyridin-2-yl)acetic Acid

Sign In for Pricing
View Details
Fmoc-Ala TentaGel® R PHB Resin
RA1301.5G 5 g

Fmoc-Ala TentaGel® R PHB Resin

Sign In for Pricing
View Details
Cytokeratin, HMW (34BE12), CF594 conjugate, 0.1mg/mL
BNC940446-100 1x 100 µL

Cytokeratin, HMW (34BE12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4,4'-(Ethyne-1,2-Diyl)Dibenzoic Acid
TRC-E941418-100MG 100 mg

4,4'-(Ethyne-1,2-Diyl)Dibenzoic Acid

Sign In for Pricing
View Details