Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Rabbit Polyclonal Antibody (Biotin)

Mxd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ma, Mad, Mad1, AW122478

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GWB-P0872A-100UG - KARS, 63-597aa, Recombinant Protein
GWB-P0872A-100UG 100 µg

GWB-P0872A-100UG - KARS, 63-597aa, Recombinant Protein

Sign In for Pricing
View Details
Nnt Antibody Middle region
ARP89037_P050 100 µL

Nnt Antibody Middle region

Sign In for Pricing
View Details
MFRP Rabbit Polyclonal Antibody (APC)
orb998554 100 µL

MFRP Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CA5A (NM_001739) Human Over-expression Lysate
LS000763 100 µg

CA5A (NM_001739) Human Over-expression Lysate

Sign In for Pricing
View Details
BPI Fold-Containing Family B Member 3 (BPIFB3) Antibody
abx007334-01 50 µL

BPI Fold-Containing Family B Member 3 (BPIFB3) Antibody

Sign In for Pricing
View Details
BPI Fold-Containing Family B Member 3 (BPIFB3) Antibody
abx007334-02 100 µL

BPI Fold-Containing Family B Member 3 (BPIFB3) Antibody

Sign In for Pricing
View Details