Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSX1 Rabbit Polyclonal Antibody (FITC)

MSX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ms, Hox, msh, Hox-, Hox7, Hox-7, Hox7., Hox7.1, AA675338, AI324650

UniProt

P13297

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse MSX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_034965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GTF2E2 shRNA (UAS) - Lentiviral human GTF2E2 shRNA (UAS, GFP) (25)
GTR15338735 1 Vial

Lentiviral human GTF2E2 shRNA (UAS) - Lentiviral human GTF2E2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS620373 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Anti-PON2 Rabbit pAb
GB113679-50 50 μL

Anti-PON2 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Slc31a2 shRNA (UAS) - Lentiviral mouse Slc31a2 shRNA (UAS, iRFP) plasmid
GTR15183736 1 Vial

Lentiviral mouse Slc31a2 shRNA (UAS) - Lentiviral mouse Slc31a2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PDZ domain-containing protein GIPC2 (GIPC2) Mouse ELISA Kit
F7440 96 Tests

PDZ domain-containing protein GIPC2 (GIPC2) Mouse ELISA Kit

Sign In for Pricing
View Details
KCNJ16 AAV Vector (Mouse) (CMV)
25380104 1 µg

KCNJ16 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details