Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSX1 Rabbit Polyclonal Antibody (HRP)

MSX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ms, Hox, msh, Hox-, Hox7, Hox-7, Hox7., Hox7.1, AA675338, AI324650

UniProt

P13297

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse MSX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_034965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAε4 Double Nickase Plasmid (h)
sc-401683-NIC 20 µg

NMDAε4 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Combi 524
OD741-1PK 1 unit

Combi 524

Sign In for Pricing
View Details
HMGA1L5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0969406 1.0 µg DNA

HMGA1L5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Complement Component 5a (C5a)
MBS2147079-01 0.1 mL

APC-Linked Monoclonal Antibody to Complement Component 5a (C5a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Complement Component 5a (C5a)
MBS2147079-02 0.2 mL

APC-Linked Monoclonal Antibody to Complement Component 5a (C5a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Complement Component 5a (C5a)
MBS2147079-03 0.5 mL

APC-Linked Monoclonal Antibody to Complement Component 5a (C5a)

Sign In for Pricing
View Details