Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFATC2 Rabbit Polyclonal Antibody (HRP)

NFATC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NF, NFA, NFAT1, Nfatp, NF-ATp, NF-ATc2, NFAT1-D, AI607462

UniProt

Q60591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_035029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mageb2 Mouse qPCR Primer Pair (NM_031171)
MP207984 200 Reactions

Mageb2 Mouse qPCR Primer Pair (NM_031171)

Sign In for Pricing
View Details
Human Shh (Sonic Hedgehog Protein) ELISA Kit
FY-EH4925 96 Well

Human Shh (Sonic Hedgehog Protein) ELISA Kit

Sign In for Pricing
View Details
RAE1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1780302 1.0 µg DNA

RAE1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-Lysine-tRNA ligase
AS15 2899 100 µL

Anti-Lysine-tRNA ligase

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida bioF Protein (aa 1-387)
VAng-Cr6734-1mgEcoli 1 mg (E. coli)

Recombinant Pasteurella Multocida bioF Protein (aa 1-387)

Sign In for Pricing
View Details
4732418C07RIK Adenovirus (Mouse)
10557054 1.0 mL

4732418C07RIK Adenovirus (Mouse)

Sign In for Pricing
View Details