Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFATC2 Rabbit Polyclonal Antibody (HRP)

NFATC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NF, NFA, NFAT1, Nfatp, NF-ATp, NF-ATc2, NFAT1-D, AI607462

UniProt

Q60591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_035029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB11 Protein Vector (Rat) (pPM-C-His)
PV251381 500 ng

ABCB11 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Gm5294 Protein Vector (Mouse) (pPB-N-His)
PV184299 500 ng

Gm5294 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Anti-SYP monoclonal antibody, clone TK37-96
DMAB5564RH 100 ul

Rabbit Anti-SYP monoclonal antibody, clone TK37-96

Sign In for Pricing
View Details
FRA14C Recombinant Protein (Human)
RP059238 100 µg

FRA14C Recombinant Protein (Human)

Sign In for Pricing
View Details
PDE4B2 Antibody
MBS543500-01 0.1 mg

PDE4B2 Antibody

Sign In for Pricing
View Details
PDE4B2 Antibody
MBS543500-02 5x 0.1 mg

PDE4B2 Antibody

Sign In for Pricing
View Details