Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFATC2 Rabbit Polyclonal Antibody (Biotin)

NFATC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NF, NFA, NFAT1, Nfatp, NF-ATp, NF-ATc2, NFAT1-D, AI607462

UniProt

Q60591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_035029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11A Antibody, Biotin conjugated
A32588-100UG 100 µg

RAB11A Antibody, Biotin conjugated

Sign In for Pricing
View Details
Fam122a Rat shRNA Plasmid (Locus ID 309420)
TR702162 1 Kit

Fam122a Rat shRNA Plasmid (Locus ID 309420)

Sign In for Pricing
View Details
Lentiviral human AUNIP shRNA (UAS) - Lentiviral human AUNIP shRNA (UAS, RFP) plasmid
GTR15088753 1 Vial

Lentiviral human AUNIP shRNA (UAS) - Lentiviral human AUNIP shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Human ZCCHC17 Protein
NBP1-51047-0.25mg 0.25 mg

Recombinant Human ZCCHC17 Protein

Sign In for Pricing
View Details
T/ADR-LBM/CTM/PE/120x110/10 AD Custom
ADM-LBM Pack of 10 Pictogram(s)

T/ADR-LBM/CTM/PE/120x110/10 AD Custom

Sign In for Pricing
View Details
Phospholipase A2 IIE Overexpression Lysate (Native) - (Dry Ice)
NBP2-10315 0.1 mg

Phospholipase A2 IIE Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details