Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFATC2 Rabbit Polyclonal Antibody (Biotin)

NFATC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NF, NFA, NFAT1, Nfatp, NF-ATp, NF-ATc2, NFAT1-D, AI607462

UniProt

Q60591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_035029

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FOXO3 Antibody [DyLight 350]
NB100-613UV 0.1 mL

Rabbit Polyclonal FOXO3 Antibody [DyLight 350]

Sign In for Pricing
View Details
Plasminogen Activator, Urokinase (uPA) BioAssayTM ELISA Kit (Bovine)
027486 96 Tests

Plasminogen Activator, Urokinase (uPA) BioAssayTM ELISA Kit (Bovine)

Sign In for Pricing
View Details
Lentiviral human HNRNPF sgRNA gene knockout kit - Lentiviral human HNRNPF sgRNA gene knockout kit (plasmid)
GTR15364238 1 Vial

Lentiviral human HNRNPF sgRNA gene knockout kit - Lentiviral human HNRNPF sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
TFIIB (GTF2B) Mouse Monoclonal Antibody [Clone 2F5]
E45M18458V-2 50 µL

TFIIB (GTF2B) Mouse Monoclonal Antibody [Clone 2F5]

Sign In for Pricing
View Details
ZNF493 (NM_145326) Human Untagged Clone
SC325458 10 µg

ZNF493 (NM_145326) Human Untagged Clone

Sign In for Pricing
View Details
Keratin 10 (BSA & Azide Free) (Biotin)
K0199-12X-Biotin 100 µL

Keratin 10 (BSA & Azide Free) (Biotin)

Sign In for Pricing
View Details