Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKX2-2 Rabbit Polyclonal Antibody (FITC)

NKX2-2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ti, Nkx2., Nkx-2., Nkx2.2, tinman, Nkx-2.2

UniProt

P42586

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LysoViewTM 594, 1000X in DMSO
#70084 1x 50 µL

LysoViewTM 594, 1000X in DMSO

Sign In for Pricing
View Details
XAGE1A (NM_001097592) Human Over-expression Lysate
LC420386 20 µg

XAGE1A (NM_001097592) Human Over-expression Lysate

Sign In for Pricing
View Details
PCDHGC5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]
TA807813BM 100 µL

PCDHGC5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]

Sign In for Pricing
View Details
SARS2 Rabbit Polyclonal Antibody
ER1902-38 100 µL

SARS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLIC4 Recombinant Rabbit Monoclonal Antibody [JE65-09]
HA722058 100 µL

CLIC4 Recombinant Rabbit Monoclonal Antibody [JE65-09]

Sign In for Pricing
View Details
Heating Element Assembly for BactiZapper Classic (B1000), 115V
B1000-RA 1 Each

Heating Element Assembly for BactiZapper Classic (B1000), 115V

Sign In for Pricing
View Details