Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKX2-2 Rabbit Polyclonal Antibody (FITC)

NKX2-2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ti, Nkx2., Nkx-2., Nkx2.2, tinman, Nkx-2.2

UniProt

P42586

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNG4 Rabbit Polyclonal Antibody
HA500259 100 µL

GNG4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF594 conjugate, 0.1mg/mL
BNC941474-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mix-n-StainTM CF®430 Antibody Labeling Kit, 1x (50-100ug) labeling
#92318 1 Kit

Mix-n-StainTM CF®430 Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein (His Tag)
PKSR030482-01 50 µg

Recombinant SARS-CoV-2 S1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein (His Tag)
PKSR030482-02 1 mg

Recombinant SARS-CoV-2 S1 Protein (His Tag)

Sign In for Pricing
View Details
TMEM68 Human Gene Knockout Kit (CRISPR)
KN423077 1 Kit

TMEM68 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details