Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKX2-2 Rabbit Polyclonal Antibody (HRP)

NKX2-2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ti, Nkx2., Nkx-2., Nkx2.2, tinman, Nkx-2.2

UniProt

P42586

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B2 (X29.2), CF488A conjugate, 0.1mg/mL
BNC883059-500 1x 500 µL

Cyclin B2 (X29.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adrb2 Mouse Gene Knockout Kit (CRISPR)
KN300934RB 1 Kit

Adrb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Il34 Mouse Gene Knockout Kit (CRISPR)
KN308286LP 1 Kit

Il34 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Cell adhesion molecULe 4 (CADM4) activation kit by CRISPRa
GA116314 1 Kit

Human Cell adhesion molecULe 4 (CADM4) activation kit by CRISPRa

Sign In for Pricing
View Details
PPP1R1C (NM_001080545) Human Over-expression Lysate
LY421099 100 µg

PPP1R1C (NM_001080545) Human Over-expression Lysate

Sign In for Pricing
View Details
Total Antioxidant Status (TAS) Colorimetric Assay Kit
E-BC-K801-M-01 48 T (32 samples)

Total Antioxidant Status (TAS) Colorimetric Assay Kit

Sign In for Pricing
View Details