Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKX2-2 Rabbit Polyclonal Antibody (Biotin)

NKX2-2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ti, Nkx2., Nkx-2., Nkx2.2, tinman, Nkx-2.2

UniProt

P42586

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E. coli PYKF Enzyme
B2015143 10 µg

E. coli PYKF Enzyme

Sign In for Pricing
View Details
UTP20 CRISPR Knock Out 293T Cell Line (Human)
49394141 1x 10^6 Cells / 1.0 mL

UTP20 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Lentiviral human NHLRC3 sgRNA gene knockout kit - Lentiviral human NHLRC3 sgRNA gene knockout kit (100)
GTR15357328 1 Vial

Lentiviral human NHLRC3 sgRNA gene knockout kit - Lentiviral human NHLRC3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
BTBD18 (NM_001145101) Human Tagged ORF Clone
RG226575 10 µg

BTBD18 (NM_001145101) Human Tagged ORF Clone

Sign In for Pricing
View Details
PSPT-094-1-YL AF Systems Consumables
018480 Roll of 100 Piece(s)

PSPT-094-1-YL AF Systems Consumables

Sign In for Pricing
View Details
FGF-19, human recombinant protein
P1050-1 1 mg

FGF-19, human recombinant protein

Sign In for Pricing
View Details