Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nkx3-1 Rabbit Polyclonal Antibody (HRP)

Nkx3-1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ba, Bax, NKX, bag, NKX3., NKX3A, NKX3.1, Nkx-3., Nkx-3.1, bagpipe

UniProt

P97436

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Nkx3-1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_035051

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7A17 ORF Vector (Human) (pORF)
35539011 1.0 µg DNA

OR7A17 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (MaxLight 550) discontinued
C2256-12N2-ML550 100 µL

CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
MGLUR3 Antibody FITC Conjugated
orb1543142 100 µL

MGLUR3 Antibody FITC Conjugated

Sign In for Pricing
View Details
Camk2a Antibody
orb1253448 0.1 mg

Camk2a Antibody

Sign In for Pricing
View Details
PHEX-AS1 ORF Vector (Human) (pORF)
ORF027704 1.0 µg DNA

PHEX-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PLK3 Rabbit pAb
MBS8547547-01 0.1 mL

PLK3 Rabbit pAb

Sign In for Pricing
View Details