Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rorc Rabbit Polyclonal Antibody (HRP)

Rorc Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Th, ROR, TOR, Thor, Nr1f3, RORgamma

UniProt

P51450

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_035411

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adipokinetic Hormone II from Schistocera gregaria
CCP1044-01 1 mg

Adipokinetic Hormone II from Schistocera gregaria

Sign In for Pricing
View Details
Adipokinetic Hormone II from Schistocera gregaria
CCP1044-02 5 mg

Adipokinetic Hormone II from Schistocera gregaria

Sign In for Pricing
View Details
Adipokinetic Hormone II from Schistocera gregaria
CCP1044-03 10 mg

Adipokinetic Hormone II from Schistocera gregaria

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) (NM_001327) Human Tagged ORF Clone Lentiviral Particle
RC213318L2V 200 µL

NY-ESO-1 (CTAG1B) (NM_001327) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Horse Tissue Inhibitors of Metalloproteinase 1 (TIMP1) ELISA Kit
orb2667567-01 48 Tests

Horse Tissue Inhibitors of Metalloproteinase 1 (TIMP1) ELISA Kit

Sign In for Pricing
View Details
Horse Tissue Inhibitors of Metalloproteinase 1 (TIMP1) ELISA Kit
orb2667567-02 96 Tests

Horse Tissue Inhibitors of Metalloproteinase 1 (TIMP1) ELISA Kit

Sign In for Pricing
View Details