Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS1 Rabbit Polyclonal Antibody (FITC)

KHDRBS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P6, Sam, p62, p68, Sam68

UniProt

Q60749

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse KHDRBS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035447

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Activated Protein C Resistance (APCR) ELISA Kit
MBS9375816 Inquire

Plant Activated Protein C Resistance (APCR) ELISA Kit

Sign In for Pricing
View Details
plakophilin 4 HDR Plasmid (m)
sc-432751-HDR 20 µg

plakophilin 4 HDR Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human TMEM126A sgRNA gene knockout kit - Lentiviral human TMEM126A sgRNA gene knockout kit (25)
GTR15400131 1 Vial

Lentiviral human TMEM126A sgRNA gene knockout kit - Lentiviral human TMEM126A sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Immunol Fluorescence Staining Kit with Alexa Fluor 555-Labeled Donkey Anti-Rabbit IgG
P0179 > 300 Tests

Immunol Fluorescence Staining Kit with Alexa Fluor 555-Labeled Donkey Anti-Rabbit IgG

Sign In for Pricing
View Details
[Trp63, 64]-C3a (63-77)
CCP1730-01 1 mg

[Trp63, 64]-C3a (63-77)

Sign In for Pricing
View Details
[Trp63, 64]-C3a (63-77)
CCP1730-02 5 mg

[Trp63, 64]-C3a (63-77)

Sign In for Pricing
View Details