Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS1 Rabbit Polyclonal Antibody (FITC)

KHDRBS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P6, Sam, p62, p68, Sam68

UniProt

Q60749

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse KHDRBS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035447

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLL2P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24690061 1.0 µg DNA

IGLL2P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CENPB (NM_001810) Human Over-expression Lysate
LS001059 100 µg

CENPB (NM_001810) Human Over-expression Lysate

Sign In for Pricing
View Details
GPSM3 Rabbit Polyclonal Antibody
E28PN0736 100 µL

GPSM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FNDC3B, NT (HCV NS5A-binding Protein 37, Factor For Adipocyte Differentiation 104, Fibronectin Type III Domain-containing Protein 3B, FAD104, NS5ABP37, UNQ2421/PRO4979/PRO34274) (MaxLight 405) discontinued
F4216-20-ML405 100 µL

FNDC3B, NT (HCV NS5A-binding Protein 37, Factor For Adipocyte Differentiation 104, Fibronectin Type III Domain-containing Protein 3B, FAD104, NS5ABP37, UNQ2421/PRO4979/PRO34274) (MaxLight 405) discontinued

Sign In for Pricing
View Details
C10orf140 (SKIDA1) Human siRNA Oligo Duplex (Locus ID 387640)
SR317920 1 Kit

C10orf140 (SKIDA1) Human siRNA Oligo Duplex (Locus ID 387640)

Sign In for Pricing
View Details
Rat Monoclonal TLR3 Antibody (27N3D4) [PerCP]
NBP2-27405PCP 0.1 mL

Rat Monoclonal TLR3 Antibody (27N3D4) [PerCP]

Sign In for Pricing
View Details