Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS1 Rabbit Polyclonal Antibody (HRP)

KHDRBS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P6, Sam, p62, p68, Sam68

UniProt

Q60749

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse KHDRBS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035447

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal USP34 Antibody
NB100-2863 0.1 mL

Rabbit Polyclonal USP34 Antibody

Sign In for Pricing
View Details
Bovine Retinol-binding protein 1 (RBP1) ELISA Kit
AE22668BO-01 48 Tests

Bovine Retinol-binding protein 1 (RBP1) ELISA Kit

Sign In for Pricing
View Details
Bovine Retinol-binding protein 1 (RBP1) ELISA Kit
AE22668BO-02 96 Tests

Bovine Retinol-binding protein 1 (RBP1) ELISA Kit

Sign In for Pricing
View Details
F10 Recombinant Protein (Mouse)
RP132599 100 µg

F10 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
POLR2D Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
37175065 1.0 µg DNA

POLR2D Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CLECL1 Antibody - N-terminal region : Biotin (ARP53214_P050-Biotin)
ARP53214_P050-Biotin 100 µL

CLECL1 Antibody - N-terminal region : Biotin (ARP53214_P050-Biotin)

Sign In for Pricing
View Details