Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sfpi1 Rabbit Polyclonal Antibody (FITC)

Sfpi1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sf, Sp, Dis, PU., Sfp, Dis1, PU.1, Dis-1, Sfpi1, Spi-1, Tcfpu, Tfpu., Sfpi-1, Tcfpu1, Tfpu.1

UniProt

P17433

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Sfpi1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL
BNC682312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PDGF-AA Recombinant Rabbit monoclonal Antibody
HA725062 100 µL

Human PDGF-AA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Optitrol HIV p24
SR11107 2x 2.5 mL

Optitrol HIV p24

Sign In for Pricing
View Details
OR2T2 Human Gene Knockout Kit (CRISPR)
KN422791 1 Kit

OR2T2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Replication Protein A2 (RPA2) (RPA2/3140R), CF647 conjugate, 0.1mg/mL
BNC473140-100 1x 100 µL

Replication Protein A2 (RPA2) (RPA2/3140R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PMS2L3 (NM_005395) Human Recombinant Protein
TP310950L 1 mg

PMS2L3 (NM_005395) Human Recombinant Protein

Sign In for Pricing
View Details