Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sfpi1 Rabbit Polyclonal Antibody (HRP)

Sfpi1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sf, Sp, Dis, PU., Sfp, Dis1, PU.1, Dis-1, Sfpi1, Spi-1, Tcfpu, Tfpu., Sfpi-1, Tcfpu1, Tfpu.1

UniProt

P17433

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Sfpi1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2AG1 (NM_001004489) Human Over-expression Lysate
LC423868 20 µg

OR2AG1 (NM_001004489) Human Over-expression Lysate

Sign In for Pricing
View Details
Mini Mixer BVMX-302
BVMX-302 1 Unit

Mini Mixer BVMX-302

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-3), CF405S conjugate, 0.1mg/mL
BNC042495-100 1x 100 µL

Lactoylglutathione Lyase (CPTC-GLO1-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-01 20 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-02 60 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-03 120 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details