Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sfpi1 Rabbit Polyclonal Antibody (Biotin)

Sfpi1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sf, Sp, Dis, PU., Sfp, Dis1, PU.1, Dis-1, Sfpi1, Spi-1, Tcfpu, Tfpu., Sfpi-1, Tcfpu1, Tfpu.1

UniProt

P17433

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Sfpi1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calmodulin Binding Protein Epitope Tag (CBP-Tag) (Biotin) discontinued
217241-Biotin 100 µL

Calmodulin Binding Protein Epitope Tag (CBP-Tag) (Biotin) discontinued

Sign In for Pricing
View Details
IL-11RA Rabbit Polyclonal Antibody (Biotin)
orb458984 100 µL

IL-11RA Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
EPB41L4A, CT (EPB41L4A, EPB41L4, Band 4.1-like protein 4A, Protein NBL4) (MaxLight 405)
MBS6295869-01 0.1 mL

EPB41L4A, CT (EPB41L4A, EPB41L4, Band 4.1-like protein 4A, Protein NBL4) (MaxLight 405)

Sign In for Pricing
View Details
EPB41L4A, CT (EPB41L4A, EPB41L4, Band 4.1-like protein 4A, Protein NBL4) (MaxLight 405)
MBS6295869-02 5x 0.1 mL

EPB41L4A, CT (EPB41L4A, EPB41L4, Band 4.1-like protein 4A, Protein NBL4) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Human General transcription and DNA repair factor IIH helicase subunit XPB (ERCC3)
orb1674889-01 20 µg

Recombinant Human General transcription and DNA repair factor IIH helicase subunit XPB (ERCC3)

Sign In for Pricing
View Details
Recombinant Human General transcription and DNA repair factor IIH helicase subunit XPB (ERCC3)
orb1674889-02 100 µg

Recombinant Human General transcription and DNA repair factor IIH helicase subunit XPB (ERCC3)

Sign In for Pricing
View Details