Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT5B Rabbit Polyclonal Antibody (FITC)

STAT5B Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P42232

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse STAT5B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQV

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_035619

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal IL-27/IL-35 EBI3 Subunit Antibody (5P6G8) [PerCP]
NBP2-03942PCP 0.1 mL

Rat Monoclonal IL-27/IL-35 EBI3 Subunit Antibody (5P6G8) [PerCP]

Sign In for Pricing
View Details
TAF13 (Transcription Initiation Factor TFIID Subunit 13, Transcription Initiation Factor TFIID 18kD Subunit, TAF (II) 18, TAFII-18, TAFII18, TAF2K, TAFII18, MGC22425) (PE)
134177-PE 100 µL

TAF13 (Transcription Initiation Factor TFIID Subunit 13, Transcription Initiation Factor TFIID 18kD Subunit, TAF (II) 18, TAFII-18, TAFII18, TAF2K, TAFII18, MGC22425) (PE)

Sign In for Pricing
View Details
CD18, Activation Epitope (Leukocyte Function Associated Antigen, LFA-1 beta2) (PE)
MBS6251469-01 0.1 mL

CD18, Activation Epitope (Leukocyte Function Associated Antigen, LFA-1 beta2) (PE)

Sign In for Pricing
View Details
CD18, Activation Epitope (Leukocyte Function Associated Antigen, LFA-1 beta2) (PE)
MBS6251469-02 5x 0.1 mL

CD18, Activation Epitope (Leukocyte Function Associated Antigen, LFA-1 beta2) (PE)

Sign In for Pricing
View Details
LMAN2L Antibody, HRP conjugated
CSB-PA863945LB01HU-01 50 µg

LMAN2L Antibody, HRP conjugated

Sign In for Pricing
View Details
LMAN2L Antibody, HRP conjugated
CSB-PA863945LB01HU-02 100 µg

LMAN2L Antibody, HRP conjugated

Sign In for Pricing
View Details