Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEA1 Rabbit Polyclonal Antibody (HRP)

TCEA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, S-II

UniProt

P10711

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse TCEA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NVSSRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYVAI

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035671

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Corazonin peptide
orb70581 5 mg

Corazonin peptide

Sign In for Pricing
View Details
Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit
MBS450288-01 48 Tests

Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit

Sign In for Pricing
View Details
Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit
MBS450288-02 96 Tests

Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit

Sign In for Pricing
View Details
Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit
MBS450288-03 5x 96 Tests

Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit

Sign In for Pricing
View Details
Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit
MBS450288-04 10x 96 Tests

Human Esophageal Cancer Related Gene 4 (ECRG4) ELISA Kit

Sign In for Pricing
View Details
OR6Y1 rabbit pAb Antibody
orb774483-01 50 μL

OR6Y1 rabbit pAb Antibody

Sign In for Pricing
View Details