Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr2c1 Rabbit Polyclonal Antibody (FITC)

Nr2c1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ee, TR, TR2, 80.3, Eenr, Tr2-1, Tr2-11, 4831444H07Rik

UniProt

Q8VIJ4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_035759

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Super Oxidase Dimutase (SOD) ELISA Kit
CK-bio-27886-01 48 Tests

Fish Super Oxidase Dimutase (SOD) ELISA Kit

Sign In for Pricing
View Details
Fish Super Oxidase Dimutase (SOD) ELISA Kit
CK-bio-27886-02 96 Tests

Fish Super Oxidase Dimutase (SOD) ELISA Kit

Sign In for Pricing
View Details
Rat Pyruvate kinase isozymes M2 (PKM2) ELISA Kit
YP-W36128-01 48 Tests

Rat Pyruvate kinase isozymes M2 (PKM2) ELISA Kit

Sign In for Pricing
View Details
Rat Pyruvate kinase isozymes M2 (PKM2) ELISA Kit
YP-W36128-02 96 Tests

Rat Pyruvate kinase isozymes M2 (PKM2) ELISA Kit

Sign In for Pricing
View Details
VILIP1 Antibody
orb1318412 100 µL

VILIP1 Antibody

Sign In for Pricing
View Details
Recombinant Thermobifida fusca Phosphate import ATP-binding protein PstB (pstB)
MBS1446565-01 0.02 mg (E-Coli)

Recombinant Thermobifida fusca Phosphate import ATP-binding protein PstB (pstB)

Sign In for Pricing
View Details