Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr2c1 Rabbit Polyclonal Antibody (HRP)

Nr2c1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ee, TR, TR2, 80.3, Eenr, Tr2-1, Tr2-11, 4831444H07Rik

UniProt

Q8VIJ4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_035759

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (Tumor Suppressor Protein, Oncogene Protein) (APC)
P1001-26D2-APC 100 µL

P53 (Tumor Suppressor Protein, Oncogene Protein) (APC)

Sign In for Pricing
View Details
PCMV-Ptx3-3xFLAG-Neo Plasmid
PVT79406 2 µg

PCMV-Ptx3-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
RITA Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11945R-BF647 100 µL

RITA Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MGAT3 Protein Vector (Rat) (pPM-C-His)
PV282105 500 ng

MGAT3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Il6 shRNA (UAS) - Lentiviral mouse Il6 shRNA (UAS) (25)
GTR15264017 1 Vial

Lentiviral mouse Il6 shRNA (UAS) - Lentiviral mouse Il6 shRNA (UAS) (25)

Sign In for Pricing
View Details
1- (2- (Methylsulfonyl) pyrimidin-5-yl) ethanone
OR1065024-01 100 mg

1- (2- (Methylsulfonyl) pyrimidin-5-yl) ethanone

Sign In for Pricing
View Details