Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRP53 Rabbit Polyclonal Antibody (HRP)

TRP53 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P4, p5, bbl, bfy, bhy, p44, p53, Tp53

UniProt

P02340

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human lgD,  40nm
GM-106-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human lgD, 40nm

Sign In for Pricing
View Details
Anti-NR1D2 Antibody
CQA7274-01 30 µL

Anti-NR1D2 Antibody

Sign In for Pricing
View Details
Anti-NR1D2 Antibody
CQA7274-02 50 μL

Anti-NR1D2 Antibody

Sign In for Pricing
View Details
Anti-NR1D2 Antibody
CQA7274-03 100 µL

Anti-NR1D2 Antibody

Sign In for Pricing
View Details
Anti-NR1D2 Antibody
CQA7274-04 200 µL

Anti-NR1D2 Antibody

Sign In for Pricing
View Details
TGIF2LY Human Over-expression Lysate
orb1352787 100 µg

TGIF2LY Human Over-expression Lysate

Sign In for Pricing
View Details