Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRP53 Rabbit Polyclonal Antibody (Biotin)

TRP53 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P4, p5, bbl, bfy, bhy, p44, p53, Tp53

UniProt

P02340

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Transmembrane 6 Superfamily Member 2 (TM6SF2) ELISA Kit
MBS9361224 Inquire

Goat Transmembrane 6 Superfamily Member 2 (TM6SF2) ELISA Kit

Sign In for Pricing
View Details
Gpatch2 Mouse siRNA Oligo Duplex (Locus ID 67769)
SR416752 1 Kit

Gpatch2 Mouse siRNA Oligo Duplex (Locus ID 67769)

Sign In for Pricing
View Details
Gpr61-set siRNA/shRNA/RNAi Lentivector (Rat)
22576096 4x 500 ng

Gpr61-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal LNX2 Antibody [DyLight 755]
NBP2-98102IR 0.1 mL

Rabbit Polyclonal LNX2 Antibody [DyLight 755]

Sign In for Pricing
View Details
C1 Inactivator Rabbit Polyclonal Antibody (BF555)
orb2402667 100 µL

C1 Inactivator Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
N, N-Dimethyl 4-bromo-3-nitrobenzylamine
OR1056156-01 100 mg

N, N-Dimethyl 4-bromo-3-nitrobenzylamine

Sign In for Pricing
View Details