Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRP53 Rabbit Polyclonal Antibody (Biotin)

TRP53 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P4, p5, bbl, bfy, bhy, p44, p53, Tp53

UniProt

P02340

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPR Antibody
A35558-100UL 100 µL

SPR Antibody

Sign In for Pricing
View Details
Srbd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4775405 3x 1.0 µg

Srbd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human SH3 domain-containing YSC84-like protein 1 ELISA Kit
EK4772 Inquire

Human SH3 domain-containing YSC84-like protein 1 ELISA Kit

Sign In for Pricing
View Details
ZKSCAN3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV632293 1.0 µg DNA

ZKSCAN3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
1M EGTA, pH 8.0
IBS-BE004 10 mL

1M EGTA, pH 8.0

Sign In for Pricing
View Details
UNCX (NM_001080461) Human Tagged ORF Clone Lentiviral Particle
RC222265L3V 200 µL

UNCX (NM_001080461) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details