Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mta2 Rabbit Polyclonal Antibody (FITC)

Mta2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mta1, mmta, mmta2, Mta1l1, Mata1l1, AW550797

UniProt

Q9R190

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC5AC Recombinant Protein
OPCD05462-10UG 10 µg

MUC5AC Recombinant Protein

Sign In for Pricing
View Details
Tm2d2 (NM_027194) Mouse Tagged ORF Clone
MR202329 10 µg

Tm2d2 (NM_027194) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Microtubule-associated protein 70-5 (MAP70.5) , partial
MBS1480047 Inquire

Recombinant Arabidopsis thaliana Microtubule-associated protein 70-5 (MAP70.5) , partial

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (PE)
246903-PE 100 µL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal MSK1/RPS6KA5 Antibody (PCRP-RPS6KA5-1A8) [mFluor Violet 450 SE]
NBP3-08282MFV450 0.1 mL

Mouse Monoclonal MSK1/RPS6KA5 Antibody (PCRP-RPS6KA5-1A8) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
ADCYAP1R1 Protein Lysate (Mouse) with C-HA Tag
11402034 100 µg

ADCYAP1R1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details