Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mta2 Rabbit Polyclonal Antibody (Biotin)

Mta2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mta1, mmta, mmta2, Mta1l1, Mata1l1, AW550797

UniProt

Q9R190

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GNG2 Antibody Picoband®
A06975-1 100 µg/Vial

Anti-GNG2 Antibody Picoband®

Sign In for Pricing
View Details
C12orf30, ID (NAA25, C12orf30, MDM20, NAP1, N-alpha-acetyltransferase 25, NatB auxiliary subunit, Mitochondrial distribution and morphology protein 20, N-terminal acetyltransferase B complex subunit MDM20, N-terminal acetyltransferase B complex subunit NAA25, p120)
032680 200 µL

C12orf30, ID (NAA25, C12orf30, MDM20, NAP1, N-alpha-acetyltransferase 25, NatB auxiliary subunit, Mitochondrial distribution and morphology protein 20, N-terminal acetyltransferase B complex subunit MDM20, N-terminal acetyltransferase B complex subunit NAA25, p120)

Sign In for Pricing
View Details
Anti-STXBP2 Antibody Picoband® (APC Conjugate)
PB9820-APC 100 µg/Vial

Anti-STXBP2 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
PRSS1 Blocking Peptide
MBS9625748-01 1 mg

PRSS1 Blocking Peptide

Sign In for Pricing
View Details
PRSS1 Blocking Peptide
MBS9625748-02 5x 1 mg

PRSS1 Blocking Peptide

Sign In for Pricing
View Details
KPRP 3'UTR GFP Stable Cell Line
TU061933 1.0 mL

KPRP 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details