Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Figla Rabbit Polyclonal Antibody (HRP)

Figla Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BHLHc, bHLHc8, FIGalpha

UniProt

O55208

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Figla

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_036143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMEP1 siRNA Oligos set (Human)
47863171 3x 5 nmol

TRMEP1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
P63 (pS455) Blocking Peptide
CBP4295-01 1 mg

P63 (pS455) Blocking Peptide

Sign In for Pricing
View Details
P63 (pS455) Blocking Peptide
CBP4295-02 5 mg

P63 (pS455) Blocking Peptide

Sign In for Pricing
View Details
Beta Amyloid 1-42 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0107R-BF647-TR 20 µL

Beta Amyloid 1-42 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Caspase 1 (CASP1) Rabbit Polyclonal Antibody
TA306200 100 µg

Caspase 1 (CASP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Prolactin (PRL) ELISA Kit
QY-E03950 96 Tests

Human Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details