Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SITPEC Rabbit Polyclonal Antibody (Biotin)

SITPEC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sit, Sitpec

UniProt

Q9QZH6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse SITPEC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit
MBS7258294-01 48 Well

Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit

Sign In for Pricing
View Details
Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit
MBS7258294-02 96 Well

Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit

Sign In for Pricing
View Details
Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit
MBS7258294-03 5x 96 Well

Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit

Sign In for Pricing
View Details
Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit
MBS7258294-04 10x 96 Well

Goat Acyl-CoA-Binding Domain-Containing Protein 6 (ACBD6) ELISA Kit

Sign In for Pricing
View Details
4-Fluoro-3-nitrophenylboronic acid
278203-01 500 mg

4-Fluoro-3-nitrophenylboronic acid

Sign In for Pricing
View Details
4-Fluoro-3-nitrophenylboronic acid
278203-02 1 g

4-Fluoro-3-nitrophenylboronic acid

Sign In for Pricing
View Details