Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL5 Rabbit Polyclonal Antibody (HRP)

CCL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, RA, Scy, MuRa, SISd, Scya5, TCP22, RANTES, TCP228, MuRantes

UniProt

P30882

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038681

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Endometrium
CR562916 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
SKAP55 Rabbit Polyclonal Antibody (BF647)
orb2522232 100 µL

SKAP55 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Penicillium brevi Cultivation Agar
M5599-500G 500 g

Penicillium brevi Cultivation Agar

Sign In for Pricing
View Details
Lentiviral human MFF shRNA (UAS) - Lentiviral human MFF shRNA (UAS, RFP) (25)
GTR15151379 1 Vial

Lentiviral human MFF shRNA (UAS) - Lentiviral human MFF shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TMEM176B Antibody Blocking Peptide
orb1514655 500 µg

TMEM176B Antibody Blocking Peptide

Sign In for Pricing
View Details
Alpha Synuclein (SNCA) Antibody (ATTO 655)
abx441684 100 µg

Alpha Synuclein (SNCA) Antibody (ATTO 655)

Sign In for Pricing
View Details