Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uncx Rabbit Polyclonal Antibody (HRP)

Uncx Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Chx4, PHD1, Uncx4.1

UniProt

P97830

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Uncx

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058875

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL1A (T-Cell Leukemia/Lymphoma Protein 1A, Tgtp, TCL1A, TCL1, T-Cell Specific GTPase, Oncogene TCL1, Protein p14 TCL1)
365243 200 µL

TCL1A (T-Cell Leukemia/Lymphoma Protein 1A, Tgtp, TCL1A, TCL1, T-Cell Specific GTPase, Oncogene TCL1, Protein p14 TCL1)

Sign In for Pricing
View Details
(S) -Lercanidipine-d3 Hydrochloride
CS-O-06714 1 Each

(S) -Lercanidipine-d3 Hydrochloride

Sign In for Pricing
View Details
Mouse Mir7679 qPCR Primer Pair
QM82006S 200 Tests

Mouse Mir7679 qPCR Primer Pair

Sign In for Pricing
View Details
FMS-like Tyrosine Kinase 3 Ligand (Flt-3L) BioAssayTM ELISA Kit (Mouse)
351639-01 48 Tests

FMS-like Tyrosine Kinase 3 Ligand (Flt-3L) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
FMS-like Tyrosine Kinase 3 Ligand (Flt-3L) BioAssayTM ELISA Kit (Mouse)
351639-02 96 Tests

FMS-like Tyrosine Kinase 3 Ligand (Flt-3L) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Hsp90 alpha Antibody, Clone M10E3R: HRP
MBS809361-01 0.1 mg

Hsp90 alpha Antibody, Clone M10E3R: HRP

Sign In for Pricing
View Details