Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snai3 Rabbit Polyclonal Antibody (HRP)

Snai3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Smu, Smuc, Zfp29, Zfp293, AI643946

UniProt

Q9QY31

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Snai3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPRSFLVKTHSSHRVPNYGKLETLREANGSCSACKELAGSRHLPDEEAPC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable oxaloacetate decarboxylase gamma chain (oadG)
MBS7024297-01 0.02 mg

Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable oxaloacetate decarboxylase gamma chain (oadG)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable oxaloacetate decarboxylase gamma chain (oadG)
MBS7024297-02 0.1 mg

Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable oxaloacetate decarboxylase gamma chain (oadG)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable oxaloacetate decarboxylase gamma chain (oadG)
MBS7024297-03 5x 0.1 mg

Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable oxaloacetate decarboxylase gamma chain (oadG)

Sign In for Pricing
View Details
TCF7L2 (Transcription Factor 7-like 2 (T-Cell Specific, HMG-Box), TCF-4, TCF4) (MaxLight 405) discontinued
252488-ML405 100 µL

TCF7L2 (Transcription Factor 7-like 2 (T-Cell Specific, HMG-Box), TCF-4, TCF4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FGF7 Antibody
orb1177910 100 µg

FGF7 Antibody

Sign In for Pricing
View Details
Compound PDK0047
orb3170309 2 g

Compound PDK0047

Sign In for Pricing
View Details